PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G07100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 274aa    MW: 30825.7 Da    PI: 9.4949
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G07100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.1e-3051101151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien++nrqvtf+kRr g+lKKA+ELSvLCdaeva+++fss+g+lyeys+
  ORUFI05G07100.1  51 KRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 101
                      79***********************************************95 PP

2K-box75.61.4e-25119204489
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                      s+ + ++e +a+++qqe+akLk++i nLq+++R l+G+++++++++eL+qLe +L+k+l kiR++K+  l +   +l+ k  e ++
  ORUFI05G07100.1 119 SNASTVAEINAQHYQQEAAKLKQQITNLQNSNRTLVGDNITTMNHRELKQLEGRLDKGLGKIRARKETELQNDNMYLKSKVAESER 204
                      34444999************************************************************************988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.21243103IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-3943102IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-3245116IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-324565IPR002100Transcription factor, MADS-box
CDDcd002651.15E-4345117No hitNo description
PROSITE patternPS0035004599IPR002100Transcription factor, MADS-box
PfamPF003193.4E-265299IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-326580IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-3280101IPR002100Transcription factor, MADS-box
PfamPF014864.6E-18128204IPR002487Transcription factor, K-box
PROSITE profilePS5129712.011129226IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MHIYKEQEAE PSTGLMMPEP APVASPGSGG SGGSGSVGAE KIGSRGKIEI KRIENTTNRQ  60
VTFCKRRSGL LKKAYELSVL CDAEVALVVF SSRGRLYEYS NNSVKETIER YKKANSDTSN  120
ASTVAEINAQ HYQQEAAKLK QQITNLQNSN RTLVGDNITT MNHRELKQLE GRLDKGLGKI  180
RARKETELQN DNMYLKSKVA ESERGLQTVN MMGSASTSEY VQNMIHYDPR NFLQFNIMHQ  240
PQYYPEQEDR KAFMSGKKYS QCNIVRVHSS TNEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-1945115272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-1945115272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-1945115272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-1945115272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2321570.0AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBankAK1117230.0AK111723.1 Oryza sativa Japonica Group cDNA clone:J023027E19, full insert sequence.
GenBankFJ7509420.0FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638060.11e-173PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-177MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLA0A0E0PIS40.0A0A0E0PIS4_ORYRU; Uncharacterized protein
STRINGLOC_Os05g11414.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.26e-84MIKC_MADS family protein